Macromolecule Insights - Protein Bioinformatics Analysis

Privacy Policy

 


The Phenylalanine Hydroylase Protein

Bookmark and Share

Sequence Alignment of the Phenylalanine Hydroxylase Protein (with Clustalw)a

Species Sequence Alignment of Phenylalanine Hydroxylase

mouse     -MAAVVLENGVLSRKLSDFGQETSYIEDNSN-QNGAVSLIFSLKEEVGALAKVLRLFEEN 58
rat       -MAAVVLENGVLSRKLSDFGQETSYIEDNSN-QNGAISLIFSLKEEVGALAKVLRLFEEN 58
human     -MSTAVLENPGLGRKLSDFGQETSYIEDNCN-QNGAISLIFSLKEEVGALAKVLRLFEEN 58
chicken   -------MDAQHCKMNGDSFQESTYTEEPSN-KNGVISLIFSLKEEVGALAKVLRTFEEK 52
fugu      MRNMRAARPEVGLNVFVQKRIGSMYLEEEIGRKFEVISCIFSLKQEVGPLTKALKLFEEK 60
zebrafish ---MDAGLTQINGGLERKGSLTSSYLEEPLN-KSGVVSCIFSLKEEVGALVEALKLFEEK 56
                           .    : * *:  . :  .:* *****:***.*.:.*: ***: 

mouse     EINLTHIESRPSRLNKDEYEFFTYLDKRSKPVLGSIIKSLRNDIGATVHELSRDKEKNTV 118
rat       DINLTHIESRPSRLNKDEYEFFTYLDKRTKPVLGSIIKSLRNDIGATVHELSRDKEKNTV 118
human     DVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTV 118
chicken   GINLTHIESRPSRLNKDEYEFFINLEGKNVPALDKIIKSLRNDIGVTVHELSRTKKKDTV 112
fugu      GINLTHIESRPSRTNTGQYEFFINVDTSCSQALDEVIDSLRTEISGHVHELSRNKEKDTV 120
zebrafish GINLTHIESRPSRKNNEEYEFFISVDQASSKVLDEIVDGLRTQIRGQVHELSRNKQKDTV 116
           :*********** :. :****  ::     .* .::. ** :*   ****** *:*:** 

mouse     PWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVE 178
rat       PWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVE 178
human     PWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVE 178
chicken   PWFPRSIQELDRFANQILSYGAELDADHPGFKDPVYRARRKEFADIAYNYRHGQPIPRVT 172
fugu      PWFPNDIQDLDRFANQILSYGSELDSDHPGFTDQVYRLRRKEFADIAYNYRHGQPIPRVE 180
zebrafish PWFPNDIQDLDRFANQILSYGSELDADHPGFTDTVYRARRKEFADIAYNYRHGQPIPRVE 176
          ****. **:************:***:*****.* *** ***:*****************  


mouse     YTEEERKTWGTVFRTLKALYKTHACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCT 238
rat       YTEEEKQTWGTVFRTLKALYKTHACYEHNHIFPLLEKYCGFREDNIPQLEDVSQFLQTCT 238
human     YMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCT 238
chicken   YTEEEKKTWGTVFRELKNLYPTHACYEHNHVFPLLEKYCGYREDNIPQLEDVSKFLQTCT 232
fugu      YTEDEKATWGKVFRELKTLYPTHACREHNRVFPLLEKYCGYKEDNIPQLEDVSRFLQSCT 240
zebrafish YTAEEKATWGTVFRELKTLYPTHACREHNRVFPLLEKYCGYREDNIPQLEDISHYLQSCT 236
          *  :*: ***.**: ** ** **** *:*::*********::*********:*::**:** 

mouse     GFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRS 298
rat       GFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRS 298
human     GFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRS 298
chicken   GFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHASKPMYTPEPDICHELLGHVPLFADPS 292
fugu      GFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHSSRPTYTPEPDVCHELLGHVPLFADSS 300
zebrafish GFRLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHSSKPMYTPEPDICHELLGHVPLFADPN 296
          *****************.********.******.*:* ******:***********:* . 

mouse     FAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKEGDSIKAYGAGLLSSFGELQYCL 358
rat       FAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKEGDSIKAYGAGLLSSFGELQYCL 358
human     FAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCL 358
chicken   FAQFSQEIGLASLGAPDDFIEKLATVYWFTVEFGLCKEGDSLKAYGAGLLSSFGELQYCL 352
fugu      FAQFSQEIGLASLGAPDEYIEKLATVYWFTVEFGLCNQGSEIRAFGAGLLSSFGELQYCL 360
zebrafish FAQFSQEIGLASLGAPDEFIEKLATVYWFTVEFGLCKQGNEVKAYGAGLLSSFGELQYCL 356
          *****************::******:**********::*..::*:*************** 

mouse     SDKPKLLPLELEKTACQEYTVTEFRPLYYVAESFNDAKEKVRTFAATIPRPFSVRYDPYT 418
rat       SDKPKLLPLELEKTACQEYSVTEFQPLYYVAESFSDAKEKVRTFAATIPRPFSVRYDPYT 418
human     SEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYT 418
chicken   SGKPEIRPLVLENTSVQKYSVTEFQPTYFVAESFNDAKEKLRKFAQTIPRPFSVRYNPYT 412
fugu      TDKPKILPFDPDKTCLQKYPITEYQPVYFVADSFENAKEKVRKFAATIPKPFSVRYNPYT 420
zebrafish TNEPKLQPFEPEKTCQQKYPITEFQPVYFVAESFEDAKEKVRRFATTIPRPFSVRYNAYT 416
          : :*:: *:  ::*. *:*.:**::* *:**:**.:****:* ** ***:******:.** 

mouse     QRVEVLDNTQQLKNLADSINSEVGILCHALQKIKS 453
rat       QRVEVLDNTQQLKILADSINSEVGILCNALQKIKS 453
human     QRIEVLDNTQQLKILADSINSEIGILCSALQKIK- 452
chicken   QRIEVLDNAKQLKNLADTINSEMGILCNALQKIK- 446
fugu      QSVEVLDDTKQLTNLADCISSEMGKLCEALRKLQ- 454
zebrafish QRIEMLDNAQQLKNLADSINGEISILCNALRKM-- 449
          * :*:**:::**. *** *..*:. ** **:*: 

Accession numbers of the phenylalanine hydroxylase protein sequences used in the protein sequence alignment:  Human - NP_000268; Mouse - NP_032803; Rat - NP_036751 ; Chicken - NP_001001298; Fugu - NP_001027850; Zebrafish - NP_956845

Predicted General Properties of the Phenylalanine Hydroxylase Protein  (Homo sapiens) - Primary Sequence Analysis (with ProtParam)b

Number of amino acids: 452

Molecular weight: 51862.0

Theoretical pI: 6.15

Total number of negatively charged residues (Asp + Glu): 60

Total number of positively charged residues (Arg + Lys): 54 Atomic composition: Carbon C 2350 Hydrogen H 3625 Nitrogen N 619 Oxygen O 683 Sulfur S 12

Formula: C2350H3625N619O683S12

Total number of atoms: 7289 Extinction coefficients: Extinction coefficients are in units of M-1 cm-1, at 280 nm measured in water. Ext. coefficient 49780 Abs 0.1% (=1 g/l) 0.960, assuming ALL Cys residues appear as half cystines Ext. coefficient 49280 Abs 0.1% (=1 g/l) 0.950, assuming NO Cys residues appear as half cystines

Estimated half-life: The N-terminal of the sequence considered is M (Met). The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro). >20 hours (yeast, in vivo). >10 hours (Escherichia coli, in vivo).

Instability index: The instability index (II) is computed to be 42.23 This classifies the protein as unstable.

Aliphatic index: 85.69

Grand average of hydropathicity (GRAVY): -0.376

Bioinformatics References

a Higgins D., Thompson J., Gibson T. Thompson J. D., Higgins D. G., Gibson T. J.(1994). CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting,position-specific gap penalties and weight matrix choice. Nucleic Acids Res. 22:4673-4680.

b Gasteiger E., Hoogland C., Gattiker A., Duvaud S., Wilkins M.R., Appel R.D., Bairoch A.; Protein Identification and Analysis Tools on the ExPASy Server;
(In) John M. Walker (ed): The Proteomics Protocols Handbook, Humana Press (2005). pp. 571-607  Full text - Copyright Humana Press.

Bookmark and Share