Macromolecule Insights - Protein Bioinformatics Analysis

Privacy Policy

 


The Matrix Metalloproteinase Protein

Bookmark and Share

Sequence Alignment of the Matrix Metalloproteinase Protein (with Clustalw)a

Isoform Sequence Alignment (Homo sapiens) of Matrix Metalloproteinases

MMP1             ---------------------------------------------------MHSFPPL-L 8
MMP8             ---------------------------------------------------MFSLKTLPF 9
MMP3             ------------------------------------------------------MKSLPI 6
MMP10            ------------------------------------------------------MMHLAF 6
MMP27            ------------------------------------------------------MKRLLL 6
MMP12            -------------------------------------------------------MKFLL 5
MMP13            ----------------------------------------------------MHPGVLAA 8
MMP7             ----------------------------------------------------MRLTVLCA 8
MMP20            ----------------------------------------------MKVLPASGLAVFLI 14
MMP2             --------------------------------------------MEALMARGALTGPLRA 16
MMP9             --------------------------------------------MSLWQP------LVLV 10
MMP26            ------------------------------------------------------MQLVIL 6
MMP19rasi-1      ------------------------------------------------------------
MMP28-1          ----------------------------------------------------MVARVGLL 8
MMP14            ----------------------------------MSPAPRPP-----------------R 9
MMP15            ----------------------------------MGSDPSAPGRPGWTGSLLGDREEAAR 26
MMP16-1          ----------------------------------MILLTFSTGR------RLDFVHHSGV 20
MMP16-2          ----------------------------------MILLTFSTGR------RLDFVHHSGV 20
MMP24            MPRSRGGRAAPGPPPPPPPPGQAPRWSRWRVPGRLLLLLLPALC------CLPGAARAAA 54
MMP17            ----------------------------------MRRRAARGPGPPPPGPGLSRLPLPLL 26
MMP25            ----------------------------------MRLR--------------LRLLALLL 12
MMP11            --------------------------------------------------------MAPA 4
MMP21            ---------------------------------MLAASIFRPTLLLCWLAAPWPTQPESL 27
MMP23B           ------------------------------------------------------------
                                                                             

MMP1             LLLFWGVVSHSFPATLETQEQD-----VDLVQKYLEKYYNLKNDGRQVEKRRNSG-PVVE 62
MMP8             LLLLHVQISKAFPVS--SKEKN-----TKTVQDYLEKFYQLPSNQYQSTRKNGTN-VIVE 61
MMP3             LLLLCVAVCSAYPLDGAARGEDT---SMNLVQKYLENYYDLKKDVKQFVRRKDSG-PVVK 62
MMP10            LVLLCLPVCSAYPLSGAAKEEDS---NKDLAQQYLEKYYNLEKDVKQFRR-KDSN-LIVK 61
MMP27            LFLFFITFSSAFPLVRMTENEE----NMQLAQAYLNQFYSLEIEGNHLVQSKNRS-LIDD 61
MMP12            ILLLQATASGALPLNSSTSLEKN---NVLFGERYLEKFYGLEINKLPVTKMKYSGNLMKE 62
MMP13            FLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASS--MTE 66
MMP7             VCLLPGSLALPLPQEAGGMSELQ----WEQAQDYLKRFYLYDS-------ETKNANSLEA 57
MMP20            MALKFSTAAPSLVAASPRTWRNN----YRLAQAYLDKYYTNKEGHQIGEMVARGSNSMIR 70
MMP2             LCLLGCLLSHAAAAPSPIIKFPG-DVAP-KTDKELAVQYLN--TFYGCPKESCNLFVLKD 72
MMP9             LLVLGCCFAAPRQRQSTLVLFPG-DLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGP 69
MMP26            RVTIFLPWCFAVPVPPAADHKG-----WDFVEGYFHQFFLTK---------KESPLLTQE 52
MMP19rasi-1      MNCQQLWLGFLLPMTVSGRVLGL---AEVAPVDYLSQYGYLQKPLEGSNNFKPED--ITE 55
MMP28-1          LRALQLLLWGHLDAQPAERGGQE---LRKEAEAFLEKYGYLNEQVPKAP--TSTR--FSD 61
MMP14            CLLLPLLTLGTALASLG-SAQSS----SFSPEAWLQQYGYLPPGDLRTHTQRSPQ-SLSA 63
MMP15            PRLLPLLLVLLGCLGLGVAAEDA----EVHAENWLRLYGYLPQPSRHMSTMRSAQ-ILAS 81
MMP16-1          FFLQT----LLWILCATVCGTEQ----YFNVEVWLQKYGYLPPTDPRMSVLRSAE-TMQS 71
MMP16-2          FFLQT----LLWILCATVCGTEQ----YFNVEVWLQKYGYLPPTDPRMSVLRSAE-TMQS 71
MMP24            AAAGAGNRAAVAVAVARADEAEA----PFAGQNWLKSYGYLLPYDSRASALHSAK-ALQS 109
MMP17            LLLALGTRGGCAAPAPAPRAEDL----SLGVE-WLSRFGYLPPADPTTGQLQTQE-ELSK 80
MMP25            LLLAPPAR------APKPSAQDV----SLGVD-WLTRYGYLPPPHPAQAQLQSPE-KLRD 60
MMP11            AWLRSAAARALLPPMLLLLLQPP----------PLLARALPPDAHHLHAERRGPQ----P 50
MMP21            FHSRDRSDLEPSPLRQAKPIADLHAAQRFLSRYGWSGVWAAWGPSPEGPPETPKGAALAE 87
MMP23B           -----MGRGARVPSEAPGAGVER---------RWLGAALVALCLLPALVLLARLGAPAVP 46
                                                                             
MMP1             KLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDV-----------------------AQ 99
MMP8             KLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDS-----------------------GG 98
MMP3             KIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDV-----------------------GH 99
MMP10            KIQGMQKFLGLEVTGKLDTDTLEVMRKPRCGVPDV-----------------------GH 98
MMP27            KIREMQAFFGLTVTGKLDSNTLEIMKTPRCGVPDV-----------------------GQ 98
MMP12            KIQEMQHFLGLKVTGQLDTSTLEMMHAPRCGVPDV-----------------------HH 99
MMP13            RLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDV-----------------------GE 103
MMP7             KLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDV-----------------------AE 94
MMP20            KIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDV-----------------------AN 107
MMP2             TLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDV-----------------------AN 109
MMP9             ALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDL-----------------------GR 106
MMP26            TQTQLLQQFHRNGTDLLDMQMHALLHQPHCGVPDG-----------------------SD 89
MMP19rasi-1      ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDP---------------------FNQK 94
MMP28-1          AIRAFQWVSQLPVSGVLDRATLRQMTRPRCGVTDTNSYAAWAERISDLFA-RHRTKMRRK 120
MMP14            AIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRR-------------- 109
MMP15            ALAEMQRFYGIPVTGVLDEETKEWMKRPRCGVPDQFGVRVKANLRRR------------R 129
MMP16-1          ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRR-------------- 117
MMP16-2          ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRR-------------- 117
MMP24            AVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHLSR--RRRN-------------- 153
MMP17            AITAMQQFGGLEATGILDEATLALMKTPRCSLPDLPVLT--QARRR-------------- 124
MMP25            AIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDVLGVAGLVRRRR-------------- 106
MMP11            WHAALPSSPAPAPATQEAPRPASSLRPPRCGVPDPSDGLSARN---------------RQ 95
MMP21            AVRRFQRANALPASGELDAATLAAMNRPRCGVPDMRPPPPSAPPSPPGPPPRARSRRSPR 147
MMP23B           AWSAAQGDVAALGLSAVPPTRVPGPLAPRRR----------------------------R 78
                                            *:                               
MMP1             FVLTEGNPRWE--------------QTHLTYRIENYT--PDLPRADVDHAIEKAFQLWSN 143
MMP8             FMLTPGNPKWE--------------RTNLTYRIRNYT--PQLSEAEVERAIKDAFELWSV 142
MMP3             FRTFPGIPKWR--------------KTHLTYRIVNYT--PDLPKDAVDSAVEKALKVWEE 143
MMP10            FSSFPGMPKWR--------------KTHLTYRIVNYT--PDLPRDAVDSAIEKALKVWEE 142
MMP27            YG--YTLPGWR--------------KYNLTYRIINYT--PDMARAAVDEAIQEGLEVWSK 140
MMP12            FREMPGGPVWR--------------KHYITYRINNYT--PDMNREDVDYAIRKAFQVWSN 143
MMP13            YNVFPRTLKWS--------------KMNLTYRIVNYT--PDMTHSEVEKAFKKAFKVWSD 147
MMP7             YSLFPNSPKWT--------------SKVVTYRIVSYT--RDLPHITVDRLVSKALNMWGK 138
MMP20            YRLFPGEPKWK--------------KNTLTYRISKYT--PSMSSVEVDKAVEMALQAWSS 151
MMP2             YNFFPRKPKWD--------------KNQITYRIIGYT--PDLDPETVDDAFARAFQVWSD 153
MMP9             FQTFEGDLKWH--------------HHNITYWIQNYS--EDLPRAVIDDAFARAFALWSA 150
MMP26            TSISPGRCKWN--------------KHTLTYRIINYP--HDMKPSAVKDSIYNAVSIWSN 133
MMP19rasi-1      TLKYLLLGRWR--------------KKHLTFRILNLP--STLPPHTARAALRQAFQDWSN 138
MMP28-1          KRFAKQGNKWY--------------KQHLSYRLVNWP--EHLPEPAVRGAVRAAFQLWSN 164
MMP14            KRYAIQGLKWQ--------------HNEITFCIQNYT--PKVGEYATYEAIRKAFRVWES 153
MMP15            KRYALTGRKWN--------------NHHLTFSIQNYT--EKLGWYHSMEAVRRAFRVWEQ 173
MMP16-1          KRYALTGQKWQ--------------HKHITYSIKNVT--PKVGDPETRKAIRRAFDVWQN 161
MMP16-2          KRYALTGQKWQ--------------HKHITYSIKNVT--PKVGDPETRKAIRRAFDVWQN 161
MMP24            KRYALTGQKWR--------------QKHITYSIHNYT--PKVGELDTRKAIRQAFDVWQK 197
MMP17            -RQAPAPTKWN--------------KRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSD 169
MMP25            -RYALSGSVWK--------------KRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGM 151
MMP11            KRFVLSGGRWE--------------KTDLTYRILRFP--WQLVQEQVRQTMAEALKVWSD 139
MMP21            APLSLSRRGWQPRGYPDGGAAQAFSKRTLSWRLLGEALSSQLSVADQRRIVALAFRMWSE 207
MMP23B           YTLTPARLRWD--------------HFNLTYRILSFPR-NLLSPRETRRALAAAFRMWSD 123
                          *                  ::: :   .    :        .  ..  *  
MMP1             VTPLTFTKVSEG--------QADIMISFVRGDHRDNSP------FDGPGGNLAHAFQPGP 189
MMP8             ASPLIFTRISQG--------EADINIAFYQRDHGDNSP------FDGPNGILAHAFQPGQ 188
MMP3             VTPLTFSRLYEG--------EADIMISFAVREHGDFYP------FDGPGNVLAHAYAPGP 189
MMP10            VTPLTFSRLYEG--------EADIMISFAVKEHGDFYS------FDGPGHSLAHAYPPGP 188
MMP27            VTPLKFTKISKG--------IADIMIAFRTRVHGRCPRY-----FDGPLGVLGHAFPPGP 187
MMP12            VTPLKFSKINTG--------MADILVVFARGAHGDFHA------FDGKGGILAHAFGPGS 189
MMP13            VTPLNFTRLHDG--------IADIMISFGIKEHGDFYP------FDGPSGLLAHAFPPGP 193
MMP7             EIPLHFRKVVWG--------TADIMIGFARGAHGDSYP------FDGPGNTLAHAFAPGT 184
MMP20            AVPLSFVRINSG--------EADIMISFENGDHGDSYP------FDGPRGTLAHAFAPGE 197
MMP2             VTPLRFSRIHDG--------EADIMINFGRWEHGDGYP------FDGKDGLLAHAFAPGT 199
MMP9             VTPLTFTRVYSR--------DADIVIQFGVAEHGDGYP------FDGKDGLLAHAFPPGP 196
MMP26            VTPLIFQQVQNG--------DADIKVSFWQWAHEDGWP------FDGPGGILGHAFLPNS 179
MMP19rasi-1      VAPLTFQEVQAG--------AADIRLSFHG-RQSSYCSN----TFDGPGRVLAHADIPEL 185
MMP28-1          VSALEFWEAPATG-------PADIRLTFFQGDHNDGLGN----AFDGPGGALAHAFLPRR 213
MMP14            ATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTP------FDGEGGFLAHAYFPGP 207
MMP15            ATPLVFQEVPYEDIRLRRQKEADIMVLFASGFHGDSSP------FDGTGGFLAHAYFPGP 227
MMP16-1          VTPLTFEEVPYSELENGK-RDVDITIIFASGFHGDSSP------FDGEGGFLAHAYFPGP 214
MMP16-2          VTPLTFEEVPYSELENGK-RDVDITIIFASGFHGDSSP------FDGEGGFLAHAYFPGP 214
MMP24            VTPLTFEEVPYHEIKSDR-KEADIMIFFASGFHGDSSP------FDGEGGFLAHAYFPGP 250
MMP17            IAPLNFHEVA--------GSAADIQIDFSKADHNDGYP------FDGPGGTVAHAFFPGH 215
MMP25            ESGLTFHEVDS-----PQGQEPDILIDFARAFHQDSYP------FDGLGGTLAHAFFPGE 200
MMP11            VTPLTFTEVHEG--------RADIMIDFARYWHGDDLP------FDGPGGILAHAFFPKT 185
MMP21            VTPLDFREDLAAPG-----AAVDIKLGFGRGRHLGCPR-----AFDGSGQEFAHAW---- 253
MMP23B           VSPFSFREVAPEQ-------PSDLRIGFYPINHTDCLVSALHHCFDGPTGELAHAFFPPH 176
                    : * .              *: : *    :           ***    ..**     
MMP1             G-IGGDAHFDEDERWTNN------------------------------------------ 206
MMP8             G-IGGDAHFDAEETWTNT------------------------------------------ 205
MMP3             G-INGDAHFDDDEQWTKD------------------------------------------ 206
MMP10            G-LYGDIHFDDDEKWTED------------------------------------------ 205
MMP27            G-LGGDTHFDEDENWTKD------------------------------------------ 204
MMP12            G-IGGDAHFDEDEFWTTH------------------------------------------ 206
MMP13            N-YGGDAHFDDDETWTSS------------------------------------------ 210
MMP7             G-LGGDAHFDEDERWTDGS----------------------------------------- 202
MMP20            G-LGGDTHFDNAEKWTMG------------------------------------------ 214
MMP2             G-VGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLW 258
MMP9             G-IQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPW 255
MMP26            G-NPGVVHFDKNEHWSAS------------------------------------------ 196
MMP19rasi-1      ----GSVHFDEDEFWTEGT----------------------------------------- 200
MMP28-1          ----GEAHFDQDERWSLSR----------------------------------------- 228
MMP14            N-IGGDTHFDSAEPWTVRNE---------------------------------------- 226
MMP15            G-LGGDTHFDADEPWTFSST---------------------------------------- 246
MMP16-1          G-IGGDTHFDSDEPWTLGNP---------------------------------------- 233
MMP16-2          G-IGGDTHFDSDEPWTLGNP---------------------------------------- 233
MMP24            G-IGGDTHFDSDEPWTLGNA---------------------------------------- 269
MMP17            HHTAGDTHFDDDEAWTFRSS---------------------------------------- 235
MMP25            HPISGDTHFDDEETWTFGSK---------------------------------------- 220
MMP11            H-REGDVHFDYDETWTIGDD---------------------------------------- 204
MMP21            --RLGDIHFDDDEHFTPPTS---------------------------------------- 271
MMP23B           G----GIHFDDSEYWVLGPTRYSWKKG--------------------------------- 199
                        ***  * :                                             
MMP1             ------------------------------------------------------------
MMP8             ------------------------------------------------------------
MMP3             ------------------------------------------------------------
MMP10            ------------------------------------------------------------
MMP27            ------------------------------------------------------------
MMP12            ------------------------------------------------------------
MMP13            ------------------------------------------------------------
MMP7             ------------------------------------------------------------
MMP20            ------------------------------------------------------------
MMP2             CSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCG 318
MMP9             CSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCA 315
MMP26            ------------------------------------------------------------
MMP19rasi-1      ------------------------------------------------------------
MMP28-1          ------------------------------------------------------------
MMP14            ------------------------------------------------------------
MMP15            ------------------------------------------------------------
MMP16-1          ------------------------------------------------------------
MMP16-2          ------------------------------------------------------------
MMP24            ------------------------------------------------------------
MMP17            ------------------------------------------------------------
MMP25            ------------------------------------------------------------
MMP11            ------------------------------------------------------------
MMP21            ------------------------------------------------------------
MMP23B           ------------------------------------------------------------
                                                                             
MMP1             ------------------------------------------------------------
MMP8             ------------------------------------------------------------
MMP3             ------------------------------------------------------------
MMP10            ------------------------------------------------------------
MMP27            ------------------------------------------------------------
MMP12            ------------------------------------------------------------
MMP13            ------------------------------------------------------------
MMP7             ------------------------------------------------------------
MMP20            ------------------------------------------------------------
MMP2             TTEDYDRDKKYGFCPETAMSTVGG-NSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCAT 377
MMP9             TTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCAT 375
MMP26            ------------------------------------------------------------
MMP19rasi-1      ------------------------------------------------------------
MMP28-1          ------------------------------------------------------------
MMP14            ------------------------------------------------------------
MMP15            ------------------------------------------------------------
MMP16-1          ------------------------------------------------------------
MMP16-2          ------------------------------------------------------------
MMP24            ------------------------------------------------------------
MMP17            ------------------------------------------------------------
MMP25            ------------------------------------------------------------
MMP11            ------------------------------------------------------------
MMP21            ------------------------------------------------------------
MMP23B           ------------------------------------------------------------
                                                                             
MMP1             --------------FREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTF----SGDVQL 248
MMP8             --------------SANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFR--ETSNYSL 249
MMP3             --------------TTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLT-DLTRFRL 251
MMP10            --------------ASGTNLFLVAAHELGHSLGLFHSANTEALMYPLYNSFT-ELAQFRL 250
MMP27            --------------GAGFNLFLVAAHEFGHALGLSHSNDQTALMFPNYVSL--DPRKYPL 248
MMP12            --------------SGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYV--DINTFRL 250
MMP13            --------------SKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYT--GKSHFML 254
MMP7             --------------SLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNG--DPQNFKL 246
MMP20            --------------TNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYK--NPYGFHL 258
MMP2             TANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYT----KNFRL 433
MMP9             TSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFT----EGPPL 431
MMP26            --------------DTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYH--DPRTFQL 240
MMP19rasi-1      --------------YRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGY---RPHFKL 243
MMP28-1          --------------RRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPYYKRL---GRDALL 271
MMP14            -------------DLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQ--WMDTENFVL 271
MMP15            -------------DLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPFYQ--WKDVDNFKL 291
MMP16-1          -------------NHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ--YMETDNFKL 278
MMP16-2          -------------NHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQ--YMETDNFKL 278
MMP24            -------------NHDGNDLFLVAVHELGHALGLEHSSDPSAIMAPFYQ--YMETHNFKL 314
MMP17            -------------DAHGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGL 282
MMP25            -------------DGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRL 267
MMP11            ---------------QGTDLLQVAAHEFGHVLGLQHTTAAKALMSAFYTFR----YPLSL 245
MMP21            --------------DTGISLLKVAVHEIGHVLGLPHTYRTGSIMQPNYIPQ---EPAFEL 314
MMP23B           --------------VWLTDLVHVAAHEIGHALGLMHSQHGRALMHLNATLR----GWKAL 241
                                   .:    .**.** :*: *     ::*               *
MMP1             AQDDIDGIQAIYG-RSQNPVQ--------------------------------------- 268
MMP8             PQDDIDGIQAIYG-LSSNPIQ--------------------------------------- 269
MMP3             SQDDINGIQSLYGPPPDSPETPLV------------------------------------ 275
MMP10            SQDDVNGIQSLYGPPPASTEEPLV------------------------------------ 274
MMP27            SQDDINGIQSIYGGLPKEPAK--------------------------------------- 269
MMP12            SADDIRGIQSLYGDPKENQRLP-------------------------------------- 272
MMP13            PDDDVQGIQSLYGPGDEDPNP--------------------------------------- 275
MMP7             SQDDIKGIQKLYGKR--------------------------------------------- 261
MMP20            PKDDVKGIQALYGPRKVFLGKPTL------------------------------------ 282
MMP2             SQDDIKGIQELYGASPDIDLG--------------------------------------- 454
MMP9             HKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPS---ERPTAGPTGP 488
MMP26            SADDIQRIQHLYG----------------------------------------------- 253
MMP19rasi-1      HPDDVAGIQALYGK---KSPVIRD--------------------------EEEEETELPT 274
MMP28-1          SWDDVLAVQSLYGKPLGGSVAVQL--------------------------PGKLFTDFET 305
MMP14            PDDDRRGIQQLYGGESGFPTKMPPQPRTTSR-PSVPD--------------KPKNP---- 312
MMP15            PEDDLRGIQQLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKPG 351
MMP16-1          PNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRP------KPPRPPTG- 331
MMP16-2          PNDDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRP------KPPRPPTG- 331
MMP24            PQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHERQP------RPPRPPLGD 368
MMP17            PYEDKVRVWQLYGVRESVSPTAQPEEPPLLPEP-PDNRSS-----------APPRK---- 326
MMP25            SQDDRDGLQQLYG-KAPQTPYDKPTRKPLAPPPQPPASPT-----------HSPSF---- 311
MMP11            SPDDCRGVQHLYGQPWPTVTSRTPALGPQAG----------------------------- 276
MMP21            DWSDRKAIQKLYGSCEGSFDTAFD------------------------------------ 338
MMP23B           SQDELWGLHRLYGCLDRLFVCAS------------------------------------- 264
                   .:   :  :**                                               
MMP1             ---------PIGPQTPKACDSKLT--------FDAITTIRGEVMFFKDRFYMRTNPFYPE 311
MMP8             ---------PTGPSTPKPCDPSLT--------FDAITTLRGEILFFKDRYFWRRHPQLQR 312
MMP3             ----PTEPVPPEPGTPANCDPALS--------FDAVSTLRGEILIFKDRHFWRKSLRKLE 323
MMP10            ----PTKSVPSGSEMPAKCDPALS--------FDAISTLRGEYLFFKDRYFWRRSHWNPE 322
MMP27            ---------PKEPTIPHACDPDLT--------FDAITTFRREVMFFKGRHLWRIYYDITD 312
MMP12            ---------NPDNSEPALCDPNLS--------FDAVTTVGNKIFFFKDRFFWLKVSERPK 315
MMP13            ----------KHPKTPDKCDPSLS--------LDAITSLRGETMIFKDRFFWRLHPQQVD 317
MMP7             --------------------SNS-----------------------------RKK----- 267
MMP20            ----PHAP-HHKPSIPDLCDSSSS--------FDAVTMLGKELLLFKDRIFWRRQVHLRT 329
MMP2             --TGPT--PTLGPVTPEICKQD--------IVFDGIAQIRGEIFFFKDRFIWRTVTPR-D 501
MMP9             PSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGS 548
MMP26            ----------------EKCSSDIP------------------------------------ 261
MMP19rasi-1      VPPVPTE----PSPMPDPCSSELD---------AMMLGPRGKTYAFKGDYVWTVSDSGPG 321
MMP28-1          WDSYSPQGRRPETQGPKYCHSSFD---------AITVDRQQQLYIFKGSHFWEVAADGNV 356
MMP14            ------------TYGPNICDGNFD----------TVAMLRGEMFVFKERWFWRVRNNQ-V 349
MMP15            PPVQPRATERPDQYGPNICDGDFD----------TVAMLRGEMFVFKGRWFWRVRHNR-V 400
MMP16-1          RPSYP-------GAKPNICDGNFN----------TLAILRREMFVFKDQWFWRVRNNR-V 373
MMP16-2          RPSYP-------GAKPNICDGNFN----------TLAILRREMFVFKDQWFWRVRNNR-V 373
MMP24            RPSTP-------GTKPNICDGNFN----------TVALFRGEMFVFKDRWFWRLRNNR-V 410
MMP17            -------------DVPHRCSTHFD----------AVAQIRGEAFFFKGKYFWRLTRDRHL 363
MMP25            -------------PIPDRCEGNFD----------AIANIRGETFFFKGPWFWRLQPSGQL 348
MMP11            -IDTNEIAPLEPDAPPDACEASFD----------AVSTIRGELFFFKAGFVWRLRGGQLQ 325
MMP21            --------------WIRKERNQYG-----------EVMVRFSTYFFRNSWYWLYENRNNR 373
MMP23B           ------------WARRGFCDARRR----------LMKRLCPSSCDFCYEFPFPTVATTPP 302
                                                                             
MMP1             ---VELNFISVFWPQLPN---GLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIY 365
MMP8             ---VEMNFISLFWPSLPT---GIQAAYEDFDRDLIFLFKGNQYWALSGYDILQGYPKDIS 366
MMP3             ---PELHLISSFWPSLPS---GVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIH 377
MMP10            ---PEFHLISAFWPSLPS---YLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQAGYPRGIH 376
MMP27            ---VEFELIASFWPSLPA---DLQAAYE-NPRDKILVFKDENFWMIRGYAVLPDYPKSIH 365
MMP12            ---TSVNLISSLWPTLPS---GIEAAYEIEARNQVFLFKDDKYWLISNLRPEPNYPKSIH 369
MMP13            ---AELFLTKSFWPELPN---RIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKIS 371
MMP7             ------------------------------------------------------------
MMP20            G--IRPSTITSSFPQLMS---NVDAAYEVAERGTAYFFKGPHYWITRGFQ-MQGPPRTIY 383
MMP2             K-PMGPLLVATFWPELPE---KIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLT 557
MMP9             R-PQGPFLIADKWPALPR---KLDSVFEERLSKKLFFFSGRQVWVYTGASVLG--PRRLD 602
MMP26            ------------------------------------------------------------
MMP19rasi-1      ---PLFR-VSALWEGLPG---NLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLN 374
MMP28-1          ---SEPRPLQERWVGLPP---NIEAAAVSLNDGDFYFFKGGRCWRFRGPKPVWGLPQLCR 410
MMP14            M-DGYPMPIGQFWRGLPA---SINTAYERK-DGKFVFFKGDKHWVFDEASLEPGYPKHIK 404
MMP15            L-DNYPMPIGHFWRGLPG---DISAAYERQ-DGRFVFFKGDRYWLFREANLEPGYPQPLT 455
MMP16-1          M-DGYPMQITYFWRGLPP---SIDAVYENS-DGNFVFFKGNKYWVFKDTTLQPGYPHDLI 428
MMP16-2          M-DGYPMQITYFWRGLPP---SIDAVYENS-DGNFVFFK--------------------- 407
MMP24            Q-EGYPMQIEQFWKGLPA---RIDAAYERA-DGRFVFFKGDKYWVFKEVTVEPGYPHSLG 465
MMP17            V-SLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVS 422
MMP25            V-SPRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGG-ARPLT 406
MMP11            P--GYPALASRHWQGLPS---PVDAAFEDA-QGHIWFFQGAQYWVYDGEKPVLGPAPLTE 379
MMP21            TRYGDPIQILTGWPGIPTHNIDAFVHIWTWKRDERYFFQGNQYWRYDSDKDQALTEDEQG 433
MMP23B           P----PRTKTRLVPEGRN--------VTFRCGQKILHKKGKVYWYKDQEPLEFSYPGYLA 350
                                                                             
MMP1             S------SFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDF 419
MMP8             N-------YGFPSSVQAIDAAVFYR--SKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAF 417
MMP3             T-------LGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDF 430
MMP10            T-------LGFPPTIRKIDAAVSDKEKKKTYFFAADKYWRFDENSQSMEQGFPRLIADDF 429
MMP27            T-------LGFPGRVKKIDAAVCDKTTRKTYFFVGIWCWRFDEMTQTMDKGFPQRVVKHF 418
MMP12            S-------FGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWRYDERRQMMDPGYPKLITKNF 422
MMP13            E-------LGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDF 424
MMP7             ------------------------------------------------------------
MMP20            D-------FGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEF 436
MMP2             S-------LGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAW 610
MMP9             K-------LGLGADVAQVTGALRSGRGK-MLLFSGRRLWRFDVKAQMVDPRSASEVDRMF 654
MMP26            ------------------------------------------------------------
MMP19rasi-1      R------------VEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLF 422
MMP28-1          AGG----------LPRHPDAALFFPPLRRLILFKGARYYVLARGGLQVEPYYPRSLQ-DW 459
MMP14            E-------LGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIK-VW 456
MMP15            S-------YGLGIPYDRIDTAIWWEPTGHTFFFQEDRYWRFNEETQRGDPGYPKPIS-VW 507
MMP16-1          T-------LGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPIT-VW 480
MMP16-2          --------------------------------VKGD------------------------ 411
MMP24            E-------LGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPIT-VW 517
MMP17            D-------FSLP-PGG-IDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSP-LW 472
MMP25            E-------LGLP-PGEEVDAVFSWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLS-LW 457
MMP11            LG---------LVRFPVHAALVWGPEKNKIYFFRGRDYWRFHPSTRRVDSPVPRRAT-DW 429
MMP21            KSYPKLISEGFPGIPSPLDTAFYDRRQKLIYFFKESLVFAFDVNRNRVLNSYPKRITEVF 493
MMP23B           LG-----EAHLSIIANAVNEGTYTCVVRRQQRVLTTYSWRVRVRG--------------- 390
                                                                             
MMP1             PGIGHK------VDAVFMKDG--FFYFFHGTRQYKFDPKT--KRILTLQK--------AN 461
MMP8             PGIESK------VDAVFQQEH--FFHVFSGPRYYAFDLIA--QRVTRVAR--------GN 459
MMP3             PGIDSK------IDAVFEEFG--FFYFFTGSSQLEFDPNA--KKVTHTLK--------SN 472
MMP10            PGVEPK------VDAVLQAFG--FFYFFSGSSQFEFDPNA--RMVTHILK--------SN 471
MMP27            PGISIR------VDAAFQYKG--FFFFSRGSKQFEYDIKT--KNITRIMR--------TN 460
MMP12            QGIGPK------IDAVFYSKNK-YYYFFQGSNQFEYDFLL--QRITKTLK--------SN 465
MMP13            PGIGDK------VDAVYEKNG--YIYFFNGPIQFEYSIWS--NRIVRVMP--------AN 466
MMP7             ------------------------------------------------------------
MMP20            SGVNGQ------IDAAVELNG--YIYFFSGPKTYKYDTEK--EDVVSVVK--------SS 478
MMP2             NAIPDN------LDAVVDLQGGGHSYFFKGAYYLKLENQS-LKSV-KFGS--------IK 654
MMP9             PGVP--------LDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGY--------VT 698
MMP26            ------------------------------------------------------------
MMP19rasi-1      TGVPNQ------PSAAMSWQDG-RVYFFKGKVYWRLNQQLRVEKGYPRNI--------SH 467
MMP28-1          GGIPEE------VSGALPRPDG-SIIFFRDDRYWRLDQAKLQATTSGRWA--------TE 504
MMP14            EGIPES------PRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKS--------AL 502
MMP15            QGIPAS------PKGAFLSNDAAYTYFYKGTKYWKFDNERLRMEPGYPKS--------IL 553
MMP16-1          KGIPES------PQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRS--------IL 526
MMP16-2          ---------------TLSIIQDGWLYKY----HWKW---ILEQRQSVP------------ 437
MMP24            KGIPQA------PQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRN--------IL 563
MMP17            RGVPST------LDDAMRWSDG-ASYFFRGQEYWKVLDGELEVAPGYPQS--------TA 517
MMP25            EGAPPS------PDDVTVSNAG-DTYFFKGAHYWRFPKNSIKTEPDAPQP--------MG 502
MMP11            RGVPSE------IDAAFQDADG-YAYFLRGRLYWKFDPVKVKALEGFPRL--------VG 474
MMP21            PAVIPQNHPFRNIDSAYYSYAYNSIFFFKGNAYWKVVNDKDKQQNSWLPANGLFPKKFIS 553
MMP23B           ------------------------------------------------------------
                                                                             


MMP1             -SWFNCRKN--------------------------------------------------- 469
MMP8             -KWLNCRYG--------------------------------------------------- 467
MMP3             -SWLNC------------------------------------------------------ 477
MMP10            -SWLHC------------------------------------------------------ 476
MMP27            -TWFQCKEPKNSSF----------------------------------GFDINKEKAHSG 485
MMP12            -SWFGC------------------------------------------------------ 470
MMP13            -SILWC------------------------------------------------------ 471
MMP7             ------------------------------------------------------------
MMP20            -SWIGC------------------------------------------------------ 483
MMP2             SDWLGC------------------------------------------------------ 660
MMP9             YDILQCPED--------------------------------------------------- 707
MMP26            ------------------------------------------------------------
MMP19rasi-1      N-WMHCRPRTIDTT----------------------------------PSGGNTTPSGTG 492
MMP28-1          LPWMGCWHANSGSA----------------------------------LF---------- 520
MMP14            RDWMGCPS--------------------GGRP----------------DEGTEEETEVII 526
MMP15            RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRV 613
MMP16-1          KDFMGCDG-------------------PTDRV----------------KEGHSPPDDVDI 551
MMP16-2          ---------------------------VLSRQ----------------TEKHKTYEELSS 454
MMP24            RDWMGCNQK------------------EVERR----------------KERRLPQDDVDI 589
MMP17            RDWLVCGDSQA----------------DGSVAAGVDA-----------AEGPRAPPGQHD 550
MMP25            PNWLDCPAP---------------------------------------SSGPRAPRPPKA 523
MMP11            PDFFGCAEPANTFL---------------------------------------------- 488
MMP21            EKWFDVCDVHISTLNM-------------------------------------------- 569
MMP23B           ------------------------------------------------------------
                                                                             
MMP1             --------------------------------------------------------
MMP8             --------------------------------------------------------
MMP3             --------------------------------------------------------
MMP10            --------------------------------------------------------
MMP27            GIKILYHKSLSLFIFGIVHLLKNTSIYQ---------------------------- 513
MMP12            --------------------------------------------------------
MMP13            --------------------------------------------------------
MMP7             --------------------------------------------------------
MMP20            --------------------------------------------------------
MMP2             --------------------------------------------------------
MMP9             --------------------------------------------------------
MMP26            --------------------------------------------------------
MMP19rasi-1      ITLDTTLSATETTFEY---------------------------------------- 508
MMP28-1          --------------------------------------------------------
MMP14            IEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV 582
MMP15            VVQMEEVARTVNVVMVLVPLLLLLCVLGLTYALVQMQRKGAPRVLLYCKRSLQEWV 669
MMP16-1          VIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV 607
MMP16-2          ITY----------------------------------------------------- 457
MMP24            MVTINDVPGSVNAVAVVIPCILSLCILVLVYTIFQFKNKTGPQPVTYYKRPVQEWV 645
MMP17            QSRSEDGYEVCSCTSGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQALTL--- 603
MMP25            TPVS----ETCDCQCELN---QAAGRWPAPIPLLLLPLLVGGVASR---------- 562
MMP11            --------------------------------------------------------
MMP21            --------------------------------------------------------
MMP23B           --------------------------------------------------------

Accession numbers of the matrix metalloproteinases used in the protein sequence alignment:  NP_002412 matrix metalloproteinase 1; NP_004521 matrix metalloproteinase 2; NP_002413 matrix metalloproteinase 3; NP_002414 matrix metalloproteinase 7; NP_002415 matrix metalloproteinase 8; NP_004985 matrix metalloproteinase 9; NP_002416 matrix metalloproteinase 10; NP_005931 matrix metalloproteinase 11; NP_002417 matrix metalloproteinase 12; NP_002418 matrix metalloproteinase 13; NP_004986 matrix metalloproteinase 14; NP_002419.1| matrix metalloproteinase 15; NP_005932 matrix metalloproteinase 16 isoform 1; NP_072086 matrix metalloproteinase 16
isoform 2; NP_057239 matrix metalloproteinase 17; NP_002420 matrix metalloproteinase 19 isoform rasi-1; NP_004762 matrix metalloproteinase 20 preproprotein; NP_671724 matrix metalloproteinase 21; NP_008914 matrix metalloproteinase 23B; NP_006681 matrix metalloproteinase 24; NP_071913
matrix metalloproteinase 25; NP_068573 matrix metalloproteinase 26; NP_071405 matrix metalloproteinase 27; NP_077278 matrix metalloproteinase 28 isoform 1

Predicted General Properties of the Matrix Metalloproteinase 1 (MMP1) Protein  (Homo sapiens) - Primary Sequence Analysis (with ProtParam)b

Number of amino acids: 469

Molecular weight: 54006.9

Theoretical pI: 6.47

Total number of negatively charged residues (Asp + Glu): 58

Total number of positively charged residues (Arg + Lys): 54

Atomic composition: Carbon C 2458 Hydrogen H 3666 Nitrogen N 656 Oxygen O 699 Sulfur S 13

Formula: C2458H3666N656O699S13

Total number of atoms: 7492

Extinction coefficients: Extinction coefficients are in units of M-1 cm-1, at 280 nm measured in water. Ext. coefficient 76905 Abs 0.1% (=1 g/l) 1.424, assuming ALL Cys residues appear as half cystines Ext. coefficient 76780 Abs 0.1% (=1 g/l) 1.422, assuming NO Cys residues appear as half cystines

Estimated half-life: The N-terminal of the sequence considered is M (Met). The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro). >20 hours (yeast, in vivo). >10 hours (Escherichia coli, in vivo).

Instability index: The instability index (II) is computed to be 35.46 This classifies the protein as stable.

Aliphatic index: 65.27

Grand average of hydropathicity (GRAVY): -0.572

Bioinformatics References

a Higgins D., Thompson J., Gibson T. Thompson J. D., Higgins D. G., Gibson T. J.(1994). CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting,position-specific gap penalties and weight matrix choice. Nucleic Acids Res. 22:4673-4680.

b Gasteiger E., Hoogland C., Gattiker A., Duvaud S., Wilkins M.R., Appel R.D., Bairoch A.; Protein Identification and Analysis Tools on the ExPASy Server;
(In) John M. Walker (ed): The Proteomics Protocols Handbook, Humana Press (2005). pp. 571-607  Full text - Copyright Humana Press.

Bookmark and Share