Macromolecule Insights - Protein Bioinformatics Analysis

Privacy Policy

 


The Histamine Receptor Protein

Bookmark and Share

Sequence Alignment of the Histamine Receptor (Homo sapiens) (with Clustalw)a

Isoform Sequence Alignment of the Histamine Receptor

H3  MERAPPDGPLNASGALAGDAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV 60
H4  -------------------MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFV 41
H1  -------MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVR 53
H2  ----------------MAPNGTASSFCLDSTACKITITVVLAVLILITVAGNVVVCLAVG 44
                           ..    : .    :. .:: : .  :  * :*  *. 

H3  ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS 120
H4  VDKNLRHRSSYFFLNLAISDFFVGVISIPLYIPHTLF-EWDFGKEICVFWLTTDYLLCTA 100
H1  SERKLHTVGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTA 113
H2  LNRRLRNLTNCFIVSLAITDLLLGLLVLPFSAIYQLSCKWSFGKVFCNIYTSLDVMLCTA 104
     :  *:   . :::.*:::*:::* . :*:   : *  .* :*: :* ::   * : .*:

H3  SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG 180
H4  SVYNIVLISYDRYLSVSNAVSYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDE 160
H1  SIFSVFILCIDRYRSVQQPLRYLKYRTKTR-ASATILGAWFLSFLWVIPILGWNHFMQQT 172
H2  SILNLFMISLDRYCAVMDPLRYPVLVTPVRVAISLVLIWVISITLSFLSIHLGWNSRNET 164
    *  .:.::. **: :*  .: *      .      ::   .   *   .     .  .  

H3  SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA 240
H4  GSE----CEPGFFSEWYILAITSFLEFVIPVILVAYFNMNIYWSLWKRDHL--------- 207
H1  SVRREDKCETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLP 232
H2  SKGNHTTSKCKVQVNEVYGLVDGLVTFYLPLLIMCITYYRIFKVARDQAKR--------- 215
    .      .   .          . : *  * : :      *:     : :          

H3  GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGG------- 293
H4  -----SRCQSHPG---------------LTAVSSNICGHSFRGRLSSRRSLS-------- 239
H1  SFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQE 292
H2  ------------------------------------------------------------
                                                                

H3  -------------------GGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLE 334
H4  -----------------------ASTEVPASFHSERQR---RKSSLMFSSRTKMNSNTIA 273
H1  DDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQML 352
H2  ---------------------------------------------INHISSWKAAT---- 226
                                                 :   .  .       

H3  KRMKMVSQS---------------------------------------FTQRFRLSRDRK 355
H4  SKMGSFSQSD---------------------------------SVALHQREHVELLRARR 300
H1  GDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERK 412
H2  -------------------------------------------------------IREHK 231
                                                            * ::

H3  VAKSLAVIVSIFGLCWAPYTLLMIIRAACHGHCVP-DYWYETSFWLLWANSAVNPVLYPL 414
H4  LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL 360
H1  AAKQLGFIMAAFILCWIPYFIFFMVIAFCKNCCNE--HLHMFTIWLGYINSTLNPLIYPL 470
H2  ATVTLAAVMGAFIICWFPYFTAFVYRGLRGDDAIN-EVLEAIVLWLGYANSALNPILYAA 290
     :  *. ::. * :** **    :  .   .            :** : ** :**::*. 

H3  CHHSFRRAFTKLLCPQKLKIQPHSSLEHCWK----------------------------- 445
H4  CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS------------------------------ 390
H1  CNENFKKTFKRILHIRS------------------------------------------- 487
H2  LNRDFRTGYQQLFCCRLANRNSHKTSLRSNASQLSRTQSREPRQQEEKPLKLQVWSGTEV 350
     :. *:  : :::  :                                            

H3  ---------
H4  ---------
H1  ---------
H2  TAPQGATDR 359                                      

Accession numbers of the histamine receptors used in the protein sequence alignments: NP_001091683 - histamine receptor H1; NP_071640 - histamine receptor H2; NP_009163 - histamine receptor H3; NP_067637 - histamine H4 receptor

Predicted General Properties of the H1 Histamine Receptor  (Homo sapiens) - Primary Sequence Analysis (with ProtParam)b

Number of amino acids: 487

Molecular weight: 55784.1

Theoretical pI: 9.33

Total number of negatively charged residues (Asp + Glu): 41

Total number of positively charged residues (Arg + Lys): 60

Atomic composition: Carbon C 2524 Hydrogen H 3957 Nitrogen N 671 Oxygen O 693 Sulfur S 31

Formula: C2524H3957N671O693S31

Total number of atoms: 7876

Extinction coefficients: Extinction coefficients are in units of M-1 cm-1, at 280 nm measured in water. Ext. coefficient 88070 Abs 0.1% (=1 g/l) 1.579, assuming ALL Cys residues appear as half cystines Ext. coefficient 87320 Abs 0.1% (=1 g/l) 1.565, assuming NO Cys residues appear as half cystines

Estimated half-life: The N-terminal of the sequence considered is M (Met). The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro). >20 hours (yeast, in vivo). >10 hours (Escherichia coli, in vivo).

Instability index: The instability index (II) is computed to be 47.00 This classifies the protein as unstable.

Aliphatic index: 90.06

Grand average of hydropathicity (GRAVY): -0.086

Bioinformatics References

a Higgins D., Thompson J., Gibson T. Thompson J. D., Higgins D. G., Gibson T. J.(1994). CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting,position-specific gap penalties and weight matrix choice. Nucleic Acids Res. 22:4673-4680.

b Gasteiger E., Hoogland C., Gattiker A., Duvaud S., Wilkins M.R., Appel R.D., Bairoch A.; Protein Identification and Analysis Tools on the ExPASy Server;
(In) John M. Walker (ed): The Proteomics Protocols Handbook, Humana Press (2005). pp. 571-607  Full text - Copyright Humana Press.

Bookmark and Share