Macromolecule Insights - Protein Bioinformatics Analysis

Privacy Policy

 


The Calcitonin Protein

Bookmark and Share

Sequence Alignment of the Calcitonin Protein (with Clustalw)a

Species Sequence Alignment of Calcitonin

human        MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ 60
mouse-calca  MGFLKFSPFLVVSILLLYQACSLQAVPLRSILESSP-GMATLSEEEVR-LLAALVQDYMQ 58
mouse-cgrp   MGFLKFSPFLVVSILLLYQACSLQAVPLRSILESSP-GMATLSEEEVR-LLAALVQDYMQ 58
dog          MGLWKSSPFLAFSILVLCQAGGLQAAPFRSALEGLP-DPTALSEKEGRLLLAALVKAYVQ 59
cow          MGFGKSSPFLAFSILVLCQAGSLQATPLRSALETLP-DPGALSEKEGRLLLAALVKAYVQ 59
chicken      MVMLKISSFLAVYALVVCQMDSFQAAPVRPGLESIT-DRVTLSDYEARRLLNALVKEFIQ 59
fugu         MVMLKISAFLLAYALVICQMYSSHAAPARPGLESMS-DRVTLTDYEARRLLNAIVKEFVQ 59
             * : * *.**    *:: *  . :*.* *. **  . .  :*:: * * ** *:*: ::*

human        MKASELEQEQERE---GSSLDSPRSKRCGNLSTCMLGTYTQDFNK-----FHTFPQTAIG 112
mouse-calca  MKARELEQEEEQE-AEGSSLDSPRSKRCGNLSTCMLGTYTQDLNK-----FHTFPQTSIG 112
mouse-cgrp   MKARELEQEEEQE-AEGSSVTAQ--KRSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVG 115
dog          RK-NELEQEQEQE-TEGSSLDSSRAKRCSNLSTCVLGTYSKDLNN-----FHTFSGIGFG 112
cow          RKTNELEQEEEQEETEDSSLDGSRAKRCSNLSTCVLSAYWKDLNN-----YHRFSGMGFG 114
chicken      MTAEELEQ-----ASEGNSLDRPISKRCASLSTCVLGKLSQELHK-----LQTYPRTDVG 109
fugu         MTAEELEQQ----ATEGNSMDRPLTKRCSNLSTCVLGKLSQELHK-----LQTFPRTNVG 110
              .  ****        ..*:     **. . :**:       : .      . :    .*

human        VGAPGKKRDMSSDLERDHRPHVSMPQNAN 141
mouse-calca  VEAPGKKRDVAKDLETNHQSHFGN----- 136
mouse-cgrp   SEAFGRRR---RDLQA------------- 128
dog          AETPGKKRDIASGLERGR----------- 130
cow          PETPGKKRDVANSLERDHSFHFGVPQDAN 143
chicken      AGTPGKKRNVLNDLDHERYANYGETLGNN 138
fugu         AGTPGKKR---SAAESDSYASYGETFGRI 136
               : *::*      :       
          

Accession numbers of the calcitonin sequences used in the protein sequence alignment:  human - CAA25103; mouse-calca - NP_031613; mouse-cgrp - NP_001029126; dog - NP_001003266; cow - BAG72140; chicken - ABY65359; fugu - CAC81278

Predicted General Properties of the Calcitonin Protein (Homo sapiens) - Primary Sequence Analysis (with ProtParam)b

Number of amino acids: 141

Molecular weight: 15467.4

Theoretical pI: 5.77

Total number of negatively charged residues (Asp + Glu): 17

Total number of positively charged residues (Arg + Lys): 14

Atomic composition: Carbon C 672 ; Hydrogen H 1066 ; Nitrogen N 192 ; Oxygen O 213; Sulfur S 7

Formula: C672H1066N192O213S7

Total number of atoms: 2150

Extinction coefficients: This protein does not contain any Trp residues. Experience shows that this could result in more than 10% error in the computed extinction coefficient. Extinction coefficients are in units of M-1 cm-1, at 280 nm measured in water. Ext. coefficient 3105 Abs 0.1% (=1 g/l) 0.201, assuming ALL Cys residues appear as half cystines Ext. coefficient 2980 Abs 0.1% (=1 g/l) 0.193, assuming NO Cys residues appear as half cystines

Estimated half-life: The N-terminal of the sequence considered is M (Met). The estimated half-life is: 30 hours (mammalian reticulocytes, in vitro). >20 hours (yeast, in vivo). >10 hours (Escherichia coli, in vivo).

Instability index: The instability index (II) is computed to be 71.34 This classifies the protein as unstable.

Aliphatic index: 72.77

Grand average of hydropathicity (GRAVY): -0.429

Bioinformatics References

a Higgins D., Thompson J., Gibson T. Thompson J. D., Higgins D. G., Gibson T. J.(1994). CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting,position-specific gap penalties and weight matrix choice. Nucleic Acids Res. 22:4673-4680.

b Gasteiger E., Hoogland C., Gattiker A., Duvaud S., Wilkins M.R., Appel R.D., Bairoch A.; Protein Identification and Analysis Tools on the ExPASy Server;
(In) John M. Walker (ed): The Proteomics Protocols Handbook, Humana Press (2005). pp. 571-607  Full text - Copyright Humana Press.

Bookmark and Share